PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.207400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family LBD
Protein Properties Length: 200aa    MW: 21683.9 Da    PI: 7.7385
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.207400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.71.7e-42311301100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++kll +lp+++r da+sslvyeA ar+rdPvyG++g i +lq+q+++l+aela
  Cucsa.207400.1  31 PCAACKILRRRCTQKCVLAPYFPPSDPLKFTIAHRIFGASNIIKLLLDLPDSQRADAVSSLVYEASARIRDPVYGCAGAICQLQKQINELQAELA 125
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  Cucsa.207400.1 126 KTQAE 130
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.29430131IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-4131128IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
PTSTLLLSHS PSPSPSPSPP PTVQAHVVVT PCAACKILRR RCTQKCVLAP YFPPSDPLKF  60
TIAHRIFGAS NIIKLLLDLP DSQRADAVSS LVYEASARIR DPVYGCAGAI CQLQKQINEL  120
QAELAKTQAE LVNIHCHQTN LVALICKELA QTPPPMSSSS LLPEHRSLDN SFNIVATPQS  180
YQGYTSLFGD SNIWDPLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819281e-176LN681928.1 Cucumis melo genomic scaffold, anchoredscaffold00004.
GenBankLN7132661e-176LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004147299.11e-145PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9SK086e-65LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A0A0LS551e-113A0A0A0LS55_CUCSA; Uncharacterized protein
STRINGGLYMA13G40370.23e-79(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.12e-65LOB domain-containing protein 11